PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa09g088970.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family B3
Protein Properties Length: 2679aa    MW: 302907 Da    PI: 6.5852
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa09g088970.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B346.47.2e-15812897196
                     EEEE-..-HHHHTT-EE--HHH.HTT..---..--SEEEEEE.TTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE.. CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeeh..ggkkeesktltled.esgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefel 92 
                     ffk l     + s+ l++p  f+ ++  g    e+kt  l++  s ++Wevk+  ++++    lt+GWkeF+ a++L+ gD+vvF+ ++++ f  
  Csa09g088970.1 812 FFKPL--LPGFYSH-LTIPVAFLLKNvkG-R-DEQKTAGLRSdASKKTWEVKI--DGQR----LTDGWKEFAVAHDLRIGDIVVFRQESNMAF-- 893
                     56666..5566666.9**********743.3.45678888886899*******..9888....***********************7666777.. PP

                     EEEE CS
              B3  93 vvkv 96 
                     +v++
  Csa09g088970.1 894 HVTM 897
                     6665 PP

2B370.32.5e-229381029496
                      E-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEE CS
              B3    4 vltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkv 96  
                      + +++++l  +rl +p++f++e+g++++++ +++l++e+grsW+v l+ +++ g  ++++GW++F++an+L++g f++Fkl+ +++++lv+++
  Csa09g088970.1  938 ANITASTLLYDRLNFPRSFVRENGLDTRCG-EIVLMNEKGRSWTVDLRCKRSCGIAYIKRGWRNFCHANELRAGSFFTFKLIIQRGRTLVLRL 1029
                      56788888899***************9987.****************98888888*************************9966777677766 PP

3B353.15.6e-1710701155390
                      EE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE CS
              B3    3 kvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsef 90  
                      +v+++ ++ + +rl+lp +f++  g++k++  ++++ d++g +W+  l+++kk  r+ l +GWkeF++an++k g++v+++l+++ ++
  Csa09g088970.1 1070 TVTLTRYNVSFSRLTLPIHFTKVSGIVKAK--KMSFLDKHGVKWSTDLRFDKKHLRMRLVGGWKEFCDANHVKIGESVMLELIWEAQE 1155
                      5666788888899********888999655..8**************************************************96433 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF813831.83E-559102IPR001810F-box domain
Gene3DG3DSA:1.20.1280.509.9E-464102No hitNo description
PfamPF006460.002167102IPR001810F-box domain
SMARTSM002560.2571112IPR001810F-box domain
SuperFamilySSF813838.5E-5440483IPR001810F-box domain
Gene3DG3DSA:1.20.1280.507.9E-4444482No hitNo description
PfamPF006460.0015445483IPR001810F-box domain
SMARTSM002562.4449492IPR001810F-box domain
PfamPF034782.1E-4666693IPR005174Domain unknown function DUF295
PROSITE profilePS5086312.167809901IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.8E-20810911IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019367.65E-18811907IPR015300DNA-binding pseudobarrel domain
CDDcd100172.40E-13811898No hitNo description
SMARTSM010191.2E-20812901IPR003340B3 DNA binding domain
PfamPF023627.3E-10822893IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.7E-209281021IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019366.67E-189301029IPR015300DNA-binding pseudobarrel domain
CDDcd100178.50E-209351027No hitNo description
PROSITE profilePS5086315.1019351033IPR003340B3 DNA binding domain
SMARTSM010194.0E-259361033IPR003340B3 DNA binding domain
PfamPF023621.0E-209371029IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.106.0E-1910601156IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.75E-1910641153IPR015300DNA-binding pseudobarrel domain
CDDcd100172.20E-1610671152No hitNo description
PROSITE profilePS5086313.28110681165IPR003340B3 DNA binding domain
SMARTSM010192.7E-1510681165IPR003340B3 DNA binding domain
PfamPF023622.0E-1610691154IPR003340B3 DNA binding domain
SuperFamilySSF813837.06E-615341577IPR001810F-box domain
Gene3DG3DSA:1.20.1280.504.6E-415391576No hitNo description
PfamPF006460.001415421577IPR001810F-box domain
SMARTSM002561.215461588IPR001810F-box domain
PfamPF034785.3E-618231873IPR005174Domain unknown function DUF295
PfamPF006460.001719341970IPR001810F-box domain
SMARTSM002562.919381981IPR001810F-box domain
PfamPF034786.1E-722202270IPR005174Domain unknown function DUF295
SMARTSM002560.1423602401IPR001810F-box domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 2679 aa     Download sequence    Send to blast
MAPRKKTPNM IWVVKKSQQP ENIAKPATQE TNKSLLDCSP LLEELPQSSN SVAEKPATKE  60
QTLSKLDWSR LPEELLHIIS ENLEDCFDVI HARSVCQPWR SIFPFPSCLL GTSYSLPSFS  120
KFPRKSKGFC TLEKFPMFLF RVLAPAVGLP SEFFVGGINR DKSVKALPSP FQCSVKVNIP  180
DSESTLLNVL DCQILPLGFQ YRMIGWDPQS LATSFRGVAS LPLGEGEFVV LIGYSHNMLV  240
LRSADMRWMR LEKTSRADCK DIVTFRGKFY AVFINGDVFV IDPYTLEATL LMPSERLNSQ  300
NYLVPSGDDE LFLVEMIIVR GSVIDFSKLA CRVSRLDEEA GEWVVVNDLG GRVLLIGQPG  360
NSSCSAKELP DGCGVSENSM LFTNEPFGST YSYKYGVDTG NAEDDLNFWR FSREKRVKIF  420
RTSPMVAHLS NMAKKEKMSS SMMPDWSQLP DELLPLISKH LEEENCFDVV HARSVCSLWR  480
SAFPFPSSLL RSSYSLPSFP GFHVEDEDSC TLEKVPLFLF RIQTPLAANV VWPSVYLLGA  540
IGRDESNDHL NLLPSNLDEN ARLSDHPSRP SVQNSLCTHL VTFRSKFYAS FGAREIFVID  600
PYSLEVTPMM PSQPLRAGDY LIPSGDDELF LVQKFYPIPV ADEIDFIRFT CRVSRLDEEA  660
GKWVVVSDLG DRVLFLGHFG NVCCSAKDLP DGCGRAEDDL NIWRFSREKR VTILSTSPVV  720
TLRVDDHSEN LALDGMLNTR DITCISVSVF VLTNYFLNTE SYVYGKGSRT LKAIFRASAP  780
ADVWPSEFFL GYSETKKRLR DLGTLIMASQ HFFKPLLPGF YSHLTIPVAF LLKNVKGRDE  840
QKTAGLRSDA SKKTWEVKID GQRLTDGWKE FAVAHDLRIG DIVVFRQESN MAFHVTMLGP  900
SCCEIQYVSS CLDDHNNLGK NPSREAESSS LDPSCFVANI TASTLLYDRL NFPRSFVREN  960
GLDTRCGEIV LMNEKGRSWT VDLRCKRSCG IAYIKRGWRN FCHANELRAG SFFTFKLIIQ  1020
RGRTLVLRLS PKEPIEEQKC SEANEESSQN EKSSLIRKAS SLASQNRYVT VTLTRYNVSF  1080
SRLTLPIHFT KVSGIVKAKK MSFLDKHGVK WSTDLRFDKK HLRMRLVGGW KEFCDANHVK  1140
IGESVMLELI WEAQECSVLK LVSSPQRATS PYRQELEDED YCFHVVHARS VCTSWRSSFP  1200
FPSCLLRPSY SLPTFSDESK VLCTVEKIPL FLFRFKTPAV SPSVFCLGDL GRDNSRDHME  1260
LPSPLQCSVR MQIRGSDPTL MNMLDCKILS LGHQYRVIGW DPESWTSPYR GVAFLPLNKE  1320
GGGEDFVVIL NFTNDLVVFR SEETRWVRLG KITDTSCQKV LTFRGRFYAA YLNGDVFVID  1380
PYSLEATLLN PAEPISPINY LVQSGNDELF LVEATIPQGE VLEVSRLTCR VSRLDEEAGK  1440
WVSEFGDRVL FIGEQGNVAC SAKELPDGCG VSGNSMLFTD WPGDAIYFYK YGVPTEYAED  1500
DLNFWRLSRE YRVKILNKSP PVVAFHFEIH TTSMSTRKKT SDWSLLPEEI LQIISKYVED  1560
CFDVVHARSV CNSWRSTFPF PSSLLRPSYS LPTFDEVTLE SKDLCTLEKV PLFLFRPRAP  1620
TIAANSSLSS QYFLGGIGRD DHHMDLPSPL QCSVKVQIQG YDPALMNMVD CQILSLGHQY  1680
RLISWEPKGY RGVAFLPLNK EGRRGEFVVI LNYTNVLLVL TSAEMKWKRL ENVPVGSVCS  1740
DLGTFRGRFY ASFLARSTFI IDPYSLEVTL LMPSPPKPLN YLVASGDDEL FLVEVTIPMF  1800
EEIDFSRFTC RVSRLDEECS KWVEVRDLGD RLLFIGHFGN VSCSGKELPD GCGLSGNSIV  1860
FTSEPTFPYK YGVHTGTGED CWRTTRENRV MIFNTDPVLA LQMHNWPLIH VFHSYNLERL  1920
SFCLNQKMSS MMPDWSQLPE ELLPLISKKL EDYCFDVVHA RSVSRTWRSV FPFPSCLVRP  1980
SYSLPSFADF PLKSKELCTL EKVPLFLFRL RAPDASAALP FEYILGGIGR DDSVELLPSP  2040
LQCRVKVKIQ GSEPTLMNML DCQIIPLGHQ YRMIGWDPER WIRYYRGVVF LPLNNDGEFV  2100
VLLSYAKVLL VLTSAEMRWK RLTNVPNYQC TDLVTYRGRF YAVFLTGKIV VIDPYSLEVT  2160
PLMPSQPLRS SNYLIPSGND DELFLVENFN PIPDADELDF NRFTCRVSRL DEAAGVWVVV  2220
SDLGDRVLFV GHFGNTCCSA KELPDGCGVT GNSILYTNGG NVTFAYKYGV HTGRPEDELN  2280
IWRFSREKRV TILSTSPALA LRSILDPQVN LCNRQPTSHN NVIVREPSPL IVSSSSRQPD  2340
PEPQIESQLG FKMSSDWFLL PEVLLHIISQ KLEDFIDVVH ARSVCSSWRS SFPFPSCLLR  2400
TRYSLPAFAD YPFKSKDLCT LEKVPLSLLR VKSPTYASKY MLGGLVRDDH MKFPSASQCS  2460
VKVKIPGSYP SLVSLHDCEI LPMWQHQYRM VGWDPKECNT YYRGVACLPL NKEGGGGEEF  2520
VVLVNYFKVL LVLSSTEMRW KRLMNIPDYP CTDLVTFRGR FYAVFFTGKI VSIDPYSLEV  2580
KNLMPSSPYK TLDYLIPSGD DELFLVEATS RVSKLDEEAG RWVEITDLGD HVLVIGQLAS  2640
VSCSVKKLPD GCGVTAKSIL FTNRPSNTTE TSISLYPH*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010429460.10.0PREDICTED: F-box/kelch-repeat protein At1g64840-like
RefseqXP_010429461.10.0PREDICTED: F-box/kelch-repeat protein At1g64840-like
SwissprotQ9XIR11e-153FBK27_ARATH; F-box/kelch-repeat protein At1g64840
TrEMBLM4ETD70.0M4ETD7_BRARP; Uncharacterized protein
STRINGBra032068.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM48625
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00260.11e-110B3 family protein